DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxc1a

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_571803.1 Gene:foxc1a / 100148408 ZFINID:ZDB-GENE-010302-1 Length:476 Species:Danio rerio


Alignment Length:99 Identity:51/99 - (51%)
Similarity:67/99 - (67%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVR 118
            |...||.::|.|||.|||.:|.:|::||:||.::|.:.||:||..|..||||||||||||..||:
Zfish    70 KDMVKPPYSYIALITMAIQNSPDKKVTLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVK 134

  Fly   119 VPRALDDPGRGHYWALDPYAEDLSIGETTGRLRR 152
            |||....||:|.||.|||  :..::.|....|||
Zfish   135 VPRDDKKPGKGSYWTLDP--DSYNMFENGSFLRR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 43/76 (57%)
foxc1aNP_571803.1 Forkhead 74..160 CDD:278670 46/87 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.