DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxg1

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001116933.1 Gene:foxg1 / 100144706 XenbaseID:XB-GENE-480076 Length:432 Species:Xenopus tropicalis


Alignment Length:274 Identity:98/274 - (35%)
Similarity:128/274 - (46%) Gaps:52/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RSLLSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMA---------------AKSNA---KPA 60
            :|||.| |.|..|..|.:..:  |.........|.|..|               .|.|.   ||.
 Frog    65 KSLLEV-KTESLPPGKGDPAA--SELPGEDKEKSEDKKADGGGGKDGENGKEGGEKKNGKYEKPP 126

  Fly    61 FTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDD 125
            |:|:|||:|||..|.||||||:||.::|..||||||..|..||||||||||||..||:|||..||
 Frog   127 FSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDD 191

  Fly   126 PGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNT------GARPKVTGHPYQRMPYYGHGHGNGP 184
            ||:|:||.|||.::|:.||.|||:|||.:.....      |||...||..:..            
 Frog   192 PGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMD------------ 244

  Fly   185 YIKAHSAYFPIMD----HQHHAAMVQHYQAMMHRYQMMPHPH-----HHQHQHQHQHPHSHFIQQ 240
              :|.|.|:|:..    |...|:....|......|...|.|:     .:.....|....|:.:..
 Frog   245 --RAGSLYWPMSPFLSLHHPRASSALSYNGTTSAYPSHPMPYSSVLTQNSLGSNHSFSTSNGLSV 307

  Fly   241 SKPLHIQEPY--HH 252
            .:.::.:.||  ||
 Frog   308 DRLVNGEIPYATHH 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 51/76 (67%)
foxg1NP_001116933.1 FH 124..212 CDD:214627 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.