DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxj3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001103516.1 Gene:foxj3 / 100126207 XenbaseID:XB-GENE-481185 Length:603 Species:Xenopus tropicalis


Alignment Length:408 Identity:104/408 - (25%)
Similarity:147/408 - (36%) Gaps:160/408 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDTTPIFQSSFSIRSLLSVDKKEESPISKHNSGSSF---SSCSSSSSNSSSDSMAAKSNAKPAFT 62
            ||..|    ..::|:.:     :.|..|:|..|:..   :|....::....:.:....:.||.::
 Frog    12 MDWLP----KITVRAAI-----QSSDCSQHAHGTGIPKKNSVLDPNTTLDQEEVQQHKDGKPPYS 67

  Fly    63 YSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPG 127
            |::||..||.||.:|::|||.|.:||.||||||:...|.|:||||||||||..|::|||:.||||
 Frog    68 YASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPG 132

  Fly   128 RGHYWALD------------------------PYAED-----------------LSIGETTGRLR 151
            :|.|||:|                        ||:.|                 |:|...|.::.
 Frog   133 KGSYWAIDTNPKEDAAQARPRKRPRSEERASTPYSIDSDSLGMDCIIPGSASPNLAINTVTNKVT 197

  Fly   152 RSNWQQNTGARPK----------------------------VTGHP-------YQRMPY------ 175
            ..|..|:....|:                            ||.||       .|:.||      
 Frog   198 LYNTDQDGNDSPRSSLNNSLSDQSVSSLNLNNVGSVHSYTSVTSHPEPSAQTLTQQSPYSAPERD 262

  Fly   176 ----------------------YGHGHGNG--------------PYIKAHSAYFPIMDHQH---- 200
                                  :.|....|              |....||....:...||    
 Frog   263 KLFPEYNFEDLSDSFRSLYKSVFEHSVSQGLMNLPSESSQQTHSPCSYQHSPSSTMSSQQHSSQN 327

  Fly   201 -----HAA-------------MVQHYQAMMHRYQMMPHPHHHQHQHQH-----QHPHSHFIQQS- 241
                 ||:             .:.|.|....:.|..||.||:...|||     ||. ||..||| 
 Frog   328 NITNSHASNLGTNVGDSMGQVHLSHTQLHTQQSQHSPHIHHNVVHHQHPQQCTQHT-SHCHQQSP 391

  Fly   242 -KPLHIQEPYHHTRYHLH 258
             :|.|.|:...|...|.|
 Frog   392 HQPQHPQQRAQHPAQHQH 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 46/76 (61%)
foxj3NP_001103516.1 FH_FOXJ3 62..140 CDD:410826 46/77 (60%)
COG5025 <63..329 CDD:227358 70/265 (26%)
KLF1_2_4_N <342..419 CDD:425360 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4323
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.