DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and foxf2

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001093702.1 Gene:foxf2 / 100101712 XenbaseID:XB-GENE-484646 Length:381 Species:Xenopus tropicalis


Alignment Length:235 Identity:71/235 - (30%)
Similarity:113/235 - (48%) Gaps:38/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SSFSIRSLLSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWS 73
            |:..||:..:....:.:.:|:.::....:|.|||||.:...:...:...||.::|.|||||||.|
 Frog    13 SAAPIRTNPATGTLQSALMSQQSTAMDTTSSSSSSSKNKKPNSGLRRPEKPPYSYIALIVMAIQS 77

  Fly    74 SSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYA 138
            |..||||||.|.:::...||::|.....|:||:|||||||..|:::|:.|..||:||||.:|| |
 Frog    78 SPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDP-A 141

  Fly   139 EDLSIGETTGRLRRSNWQQ-----------------NTGARPKVTGHPYQRMPYYGHGHGNGPYI 186
            .:....|.:.|.|...:::                 :|...|:  |..:|..|.....|.||   
 Frog   142 SEFMFEEGSFRRRPRGFRRKCQALKPMYRMMNGIGFSTSILPQ--GFDFQAPPASLTCHSNG--- 201

  Fly   187 KAHSAYFPIMDHQHHAAMVQHYQAMMHRYQMMPHPHHHQH 226
                         ::..|:.:  :|...|..:...||..|
 Frog   202 -------------YNLDMMSN--SMAGGYDGLAGGHHVPH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 41/76 (54%)
foxf2NP_001093702.1 Forkhead 61..147 CDD:365978 44/86 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.