DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd19B and si:ch211-145o7.3

DIOPT Version :9

Sequence 1:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_001923743.3 Gene:si:ch211-145o7.3 / 100003583 ZFINID:ZDB-GENE-061207-6 Length:332 Species:Danio rerio


Alignment Length:288 Identity:68/288 - (23%)
Similarity:97/288 - (33%) Gaps:116/288 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PISKHNSG---------SSFSSCSSSSSNSSSDSMAA---------------------------- 53
            |.|.|:|.         |..|.|.|.|:....|.:..                            
Zfish    33 PASLHSSHLHSSSSPRVSGGSHCLSLSTAPEQDDLTCLNWLHQRGNLLPLQPLPKISTLPQMFDP 97

  Fly    54 -------KSNAKPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLS 111
                   .|.|||.:::|:||.|||..|.||.|.:.||.:||.:|||||:.....|:||:|||||
Zfish    98 IPAQHLPSSPAKPPYSFSSLIFMAIEDSPEKSLPVKGIYEWIVENFPYYKEAPGGWRNSVRHNLS 162

  Fly   112 LNPFFVRVPR-ALDDPGRGHYWALDPYAED--LSIGETTGRLRRSNWQ--------------QN- 158
            |:..|.|:.| .....|:|..|.:.|....  |.:...|....|:|..              || 
Zfish   163 LSKSFQRIHRDKSQSVGKGSLWRVCPEYRPALLEVLRKTHYCHRTNRSLLNKPVLLEATDNGQNM 227

  Fly   159 --------------------------------TGARPKVTGHPYQRMPYYGHGHGNGPYIKAHSA 191
                                            :...|:|||...::.|....|     ||:.|  
Zfish   228 FNETMELSDLDSLSSNPPCSFTPDHEELIPMESVGLPEVTGEDTEKDPLADSG-----YIELH-- 285

  Fly   192 YFPIMDHQHHAAMVQHYQAMMHRYQMMP 219
                           :||...::|.::|
Zfish   286 ---------------YYQYQQYQYLVLP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd19BNP_608369.1 FH 58..135 CDD:238016 36/77 (47%)
si:ch211-145o7.3XP_001923743.3 Forkhead 109..196 CDD:278670 37/86 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.