DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop2R and CG13579

DIOPT Version :9

Sequence 1:NP_001014758.2 Gene:Dop2R / 33007 FlyBaseID:FBgn0053517 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_001261169.1 Gene:CG13579 / 37905 FlyBaseID:FBgn0035010 Length:716 Species:Drosophila melanogaster


Alignment Length:560 Identity:117/560 - (20%)
Similarity:178/560 - (31%) Gaps:187/560 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 SCGELRVVDHNYWA---------LILILFPILTLFG-NILVILSVCRER---SLQTVTNYFIVSL 417
            ||...|...||:.|         .:|||...|.:.| |.|||..:...|   .:.....|.:.||
  Fly    18 SCSHPRYSGHNFIAHIGIAETIEAVLILVLTLGVIGANCLVIFVINNRRYAAYIHQQPRYLLTSL 82

  Fly   418 AIADLLVAVVVMPFAVYFLVNGAWALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIK 482
            |:.||.:.:::.||.:...:...|...::.|.....:....|..|...||.:::|||:....|.:
  Fly    83 ALNDLTIGLLITPFGLMPALFHCWPYGEIFCQIQALLRGALSQQSAVILVCMAVDRYMCALHPRR 147

  Fly   483 YAKHKNSRRVCLTIL-LVWAISAAIGSPIVLG----LNNTPNR--EPDVCAFYNADFILYSSLSS 540
            |.:| :|::.|:.|| |.|.||..:...:||.    .|||...  ||    ||:.......|..:
  Fly   148 YYQH-SSKKGCVAILSLTWIISLTVFGFLVLPKGYYFNNTGLMACEP----FYSKPSYRILSTCA 207

  Fly   541 FYIPCIIMVFLYWNIFKALRSRARKQRAARKPHLSELTGGSVIENIAQTRRLAETALDSSRHASR 605
            .|.| ..||.:|                                           ...||.|.||
  Fly   208 LYFP-TTMVLMY-------------------------------------------CYGSSFHMSR 228

  Fly   606 I-LPDEAATNTASGSNEEEDENAISPDIDDCHVIVNDKSTEFMLATVVEETGNSVVAQITTQPQL 669
            . |.|.....||:..:.....:.                                    |...||
  Fly   229 FRLNDPTMPLTAAAHHPHPHPHP------------------------------------TAAQQL 257

  Fly   670 VVADPNGNHDSGYAASNVDDVLAGVAPASASAATSAAPRSSGSPPDSPLPSGATLQRSSVSSQRR 734
            .:.....:|..           ||:                    .|.|..|.:...|..|....
  Fly   258 QMHQHQQHHQQ-----------AGM--------------------HSHLYHGHSHHPSHPSHPNH 291

  Fly   735 PTGDDSPKRGEPALRSVGVDNSSVAMKPLSFVRYGVQEAMTLARNDSTLSTTSKTSSRKDKKNSQ 799
            |.....|....|.:    :.:.|:||            :|.||...:..:..:|......:|||.
  Fly   292 PNHHGHPHHHGPPV----MGHLSMAM------------SMGLAGMPNMTNKITKKIVPIQEKNSS 340

  Fly   800 ASRFTIYKVHKASKKKREKSSAKKERKATKTLAIVLGVFLFCWLPFFSCNIMDAMCAKFKKDCRP 864
            .|              ..:|.|          ||.|| |:....|:....|:.| |...|     
  Fly   341 GS--------------TSRSMA----------AISLG-FIVMVTPWTIQEIVTA-CTGSK----- 374

  Fly   865 GLTAYM--MTTWLGYINSFVNPVIYTIFNPEFRKAFKKIM 902
             |..::  :.||....||..||.:|.:.|.:||:..:::|
  Fly   375 -LPPFLDFLVTWTALSNSLWNPFMYWLLNSDFRRMSRQLM 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop2RNP_001014758.2 7tmA_D2-like_dopamine_R 376..>565 CDD:320181 55/208 (26%)
TM helix 1 377..403 CDD:320181 10/35 (29%)
TM helix 2 410..436 CDD:320181 8/25 (32%)
TM helix 3 448..478 CDD:320181 8/29 (28%)
TM helix 4 490..513 CDD:320181 8/23 (35%)
TM helix 5 529..558 CDD:320181 6/28 (21%)
7tm_GPCRs <822..898 CDD:333717 21/77 (27%)
TM helix 6 825..850 CDD:320095 6/24 (25%)
TM helix 7 866..891 CDD:320095 8/26 (31%)
CG13579NP_001261169.1 7tm_4 51..>148 CDD:304433 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.