DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop2R and DRD3

DIOPT Version :9

Sequence 1:NP_001014758.2 Gene:Dop2R / 33007 FlyBaseID:FBgn0053517 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_000787.2 Gene:DRD3 / 1814 HGNCID:3024 Length:400 Species:Homo sapiens


Alignment Length:562 Identity:166/562 - (29%)
Similarity:230/562 - (40%) Gaps:192/562 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 NETLNLTDSCGELRVVDHNYWALILILFPILTLFGNILVILSVCRERSLQTVTNYFIVSLAIADL 422
            |.|....:|.|..:...|.|:||......:..:|||.||.::|.:||:|||.|||.:||||:|||
Human    12 NYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADL 76

  Fly   423 LVAVVVMPFAVYF-LVNGAWALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIKYAKH 486
            |||.:|||:.||. :..|.|....:.||.::.:||:..|:||.||.|||||||.||..|:.| :|
Human    77 LVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHY-QH 140

  Fly   487 ----KNSRRVCLTILLVWAISAAIGSPIVLGLNNTPNREPDVCAFYNADFILYSSLSSFYIPCII 547
                .:.|||.|.|..||.::.|:..|::.|.|.|  .:|.||:..|.||::|||:.|||:|..:
Human   141 GTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTT--GDPTVCSISNPDFVIYSSVVSFYLPFGV 203

  Fly   548 MVFLYWNIFKALRSRARKQRAARKPHLSELTGGSVIENIAQTRRLAETA-LDSSRHASRILPDEA 611
            .|.:|..|:..|:.|.||:...|:    .....||.....|.....:.| |:..|:.|      .
Human   204 TVLVYARIYVVLKQRRRKRILTRQ----NSQCNSVRPGFPQQTLSPDPAHLELKRYYS------I 258

  Fly   612 ATNTASG-----------SNEEEDENAISPDIDDCHVIVNDKSTEFMLATVVEETGNSVVAQITT 665
            ..:||.|           ..||:..|::||.|                                 
Human   259 CQDTALGGPGFQERGGELKREEKTRNSLSPTI--------------------------------- 290

  Fly   666 QPQLVVADPNGNHDSGYAASNVDDVLAGVAPASASAATSAAPRSSGSPPDSPLPSGATLQRSSVS 730
                                                    ||:.|             |:...:|
Human   291 ----------------------------------------APKLS-------------LEVRKLS 302

  Fly   731 SQRRPTGDDSPKRGEPALRSVGVDNSSVAMKPLSFVRYGVQEAMTLARNDSTLSTTSKTSSRKDK 795
            :.|..|   |.|.|....|.|          ||                                
Human   303 NGRLST---SLKLGPLQPRGV----------PL-------------------------------- 322

  Fly   796 KNSQASRFTIYKVHKASKKKREKSSAKKERKATKTLAIVLGVFLFCWLPFFSCNIMDAMCAKFKK 860
                                       :|:|||:.:|||||.|:.||||||..::::..|    :
Human   323 ---------------------------REKKATQMVAIVLGAFIVCWLPFFLTHVLNTHC----Q 356

  Fly   861 DCRPGLTAYMMTTWLGYINSFVNPVIYTIFNPEFRKAFKKIM 902
            .|......|..||||||:||.:||||||.||.||||||.||:
Human   357 TCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKIL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop2RNP_001014758.2 7tmA_D2-like_dopamine_R 376..>565 CDD:320181 85/193 (44%)
TM helix 1 377..403 CDD:320181 9/25 (36%)
TM helix 2 410..436 CDD:320181 18/26 (69%)
TM helix 3 448..478 CDD:320181 17/29 (59%)
TM helix 4 490..513 CDD:320181 9/22 (41%)
TM helix 5 529..558 CDD:320181 13/28 (46%)
7tm_GPCRs <822..898 CDD:333717 39/75 (52%)
TM helix 6 825..850 CDD:320095 15/24 (63%)
TM helix 7 866..891 CDD:320095 15/24 (63%)
DRD3NP_000787.2 7tm_4 44..>216 CDD:304433 80/174 (46%)
7tm_1 46..383 CDD:278431 144/511 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 246 1.000 Domainoid score I2175
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 282 1.000 Inparanoid score I2884
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1733
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.