DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17003 and Atat1

DIOPT Version :9

Sequence 1:NP_608365.1 Gene:CG17003 / 33006 FlyBaseID:FBgn0031082 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001136216.1 Gene:Atat1 / 73242 MGIID:1913869 Length:421 Species:Mus musculus


Alignment Length:221 Identity:91/221 - (41%)
Similarity:124/221 - (56%) Gaps:30/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VEFAFDIKHLFPQSIIRVQAHSLRPKVTQCRRYAQTERGKSTMTSCRL---SEILNI---MGKLS 60
            :||.||:..|||:.|..:..| |||..          |...|.|..|:   .:|:.|   :||.|
Mouse     1 MEFPFDVDALFPERITVLDQH-LRPPA----------RRPGTTTPARVDLQQQIMTIVDELGKAS 54

  Fly    61 ADAQGLCHAVTSADKLASDQ-VVYLMAD---KAAGHWEITGLLKVGTKDLFVFDQGGCYRRLNQT 121
            |.||.|...:|||.::.|:: |:|::.|   :.||...|.|.||||.|.|||.|....:..: :.
Mouse    55 AKAQHLPAPITSALRMQSNRHVIYILKDTSARPAGKGAIIGFLKVGYKKLFVLDDREAHNEV-EP 118

  Fly   122 PAILDFYVHESRQRCGQGKLLFEWMLEKQGWSAHKCTVDRPSNKMLAFMAKHYGLVRTIPQGNNF 186
            ..|||||:|||.||.|.|:.||:.||:|:....|:..:||||.|:|.|:.|||.|..|:||.|||
Mouse   119 LCILDFYIHESVQRHGHGRELFQHMLQKERVEPHQLAIDRPSPKLLKFLNKHYNLETTVPQVNNF 183

  Fly   187 VLYEGFF---DDPITTCKSASGLQAT 209
            |::||||   ..|.|     |.|:||
Mouse   184 VIFEGFFAHQHRPPT-----SSLRAT 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17003NP_608365.1 Mec-17 84..194 CDD:283063 54/115 (47%)
Atat1NP_001136216.1 Mec-17 79..190 CDD:283063 52/111 (47%)
Acetyl-CoA binding. /evidence=ECO:0000255|HAMAP-Rule:MF_03130 124..137 8/12 (67%)
Acetyl-CoA binding. /evidence=ECO:0000255|HAMAP-Rule:MF_03130 160..169 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..235 6/14 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..284
Required for AP2A2-binding 308..387
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849247
Domainoid 1 1.000 136 1.000 Domainoid score I4906
eggNOG 1 0.900 - - E1_KOG4601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005717
OrthoInspector 1 1.000 - - otm43190
orthoMCL 1 0.900 - - OOG6_103430
Panther 1 1.100 - - O PTHR12327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.700

Return to query results.
Submit another query.