DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17003 and atat1

DIOPT Version :9

Sequence 1:NP_608365.1 Gene:CG17003 / 33006 FlyBaseID:FBgn0031082 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001315193.1 Gene:atat1 / 406389 ZFINID:ZDB-GENE-040426-2120 Length:453 Species:Danio rerio


Alignment Length:253 Identity:83/253 - (32%)
Similarity:121/253 - (47%) Gaps:55/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VEFAFDIKHLFPQSIIRV--------QAHSLRPKVTQCRRYAQTERGKSTMTSCRLSEILNIMGK 58
            ::|.:|:..|||:.|..:        :||.....:.|                  ::.:::.:||
Zfish     1 MDFPYDLNALFPERISVLDSNLSAGRKAHGRPDPLPQ------------------VTTVIDELGK 47

  Fly    59 LSADAQGLCHAVTSADKL-ASDQVVYLMAD--KAAGHWEITGLLKVGTKDLFVFDQGGCYRRLNQ 120
            .|:.||.|...:|||.|| |:...:||:.|  :..|...|.|.||||.|.||:.||.|.:  |..
Zfish    48 ASSKAQQLPAPITSAAKLQANRHHLYLLKDGEQNGGRGVIVGFLKVGYKKLFLLDQRGAH--LET 110

  Fly   121 TP-AILDFYVHESRQRCGQGKLLFEWMLEKQGWSAHKCTVDRPSNKMLAFMAKHYGLVRTIPQGN 184
            .| .:|||||.|:.||.|.|..||::||:.:.....:...||||.|.|:|:.|.|.|..::||.|
Zfish   111 EPLCVLDFYVTETLQRHGYGSELFDFMLKHKQVEPAQMAYDRPSPKFLSFLEKRYDLRNSVPQVN 175

  Fly   185 NFVLYEGFFD-------DPIT--------------TCKSASGLQAT--GSGCRSRSQG 219
            |||::.|||.       .|:|              :.|.|.|...|  .:|.||.|.|
Zfish   176 NFVVFAGFFQSRSGTPPSPLTDQGMYGFFGPTEKSSPKKARGRDQTLFANGKRSGSGG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17003NP_608365.1 Mec-17 84..194 CDD:283063 49/112 (44%)
atat1NP_001315193.1 Mec-17 74..185 CDD:283063 49/112 (44%)
Acetyl-CoA binding. /evidence=ECO:0000255|HAMAP-Rule:MF_03130, ECO:0000269|PubMed:23105108, ECO:0000269|PubMed:23128673 118..131 7/12 (58%)
Acetyl-CoA binding. /evidence=ECO:0000255|HAMAP-Rule:MF_03130, ECO:0000269|PubMed:23105108, ECO:0000269|PubMed:23128673 154..163 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594827
Domainoid 1 1.000 123 1.000 Domainoid score I5540
eggNOG 1 0.900 - - E1_KOG4601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4952
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005717
OrthoInspector 1 1.000 - - otm26579
orthoMCL 1 0.900 - - OOG6_103430
Panther 1 1.100 - - O PTHR12327
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4476
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.