DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17003 and Tat

DIOPT Version :9

Sequence 1:NP_608365.1 Gene:CG17003 / 33006 FlyBaseID:FBgn0031082 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648309.1 Gene:Tat / 39086 FlyBaseID:FBgn0035989 Length:461 Species:Drosophila melanogaster


Alignment Length:288 Identity:121/288 - (42%)
Similarity:166/288 - (57%) Gaps:44/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVEFAFDIKHLFPQSIIRVQAHSLRPKVTQCRRYAQTERGKSTM---TSCRLSEILNIMGKLSAD 62
            ||||.||||.||.|.||:|.::.|          ..|.||....   .:.:::||::.:|:|||.
  Fly     1 MVEFRFDIKPLFAQPIIKVTSNLL----------PNTFRGDRRQCLDATSKMTEIIDQLGQLSAT 55

  Fly    63 AQGLCHAVTSADKL--ASDQVVYLMADKAAGH-WEITGLLKVGTKDLFVFDQGGCYRRLNQTPAI 124
            :|||...||:|.:|  :.:|.:||:||..||| ..:.||||||||:|::||:.|..|.:.|||:|
  Fly    56 SQGLSKPVTTAQRLRMSDNQTIYLLADNEAGHNGAVLGLLKVGTKNLYLFDEAGKTRMVEQTPSI 120

  Fly   125 LDFYVHESRQRCGQGKLLFEWMLEKQGWSAHKCTVDRPSNKMLAFMAKHYGLVRTIPQGNNFVLY 189
            |||||||||||.|.||.||:.||.::.|:|.||:|||||.|:|:|::|||||.|.|||.||||||
  Fly   121 LDFYVHESRQRAGLGKRLFQTMLNEEQWTARKCSVDRPSEKLLSFLSKHYGLKRIIPQANNFVLY 185

  Fly   190 EGFFDDPITTCKSASGLQATGSGCRSRSQGHYVRQEQDQAQIKHGQANRNTVQNDANSGPFRQDQ 254
            ||||:|         |....|.|     .||           .:|..|...:.|..|:..|   .
  Fly   186 EGFFND---------GESGNGGG-----NGH-----------ANGTPNGLHITNSPNTHLF---G 222

  Fly   255 KIVVGTSIYRRRWKSPRTLARAGCREVS 282
            ...:|....:||....:|...|..::::
  Fly   223 ATYLGEDSNQRRGSQQQTTPNARLQQIT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17003NP_608365.1 Mec-17 84..194 CDD:283063 71/110 (65%)
TatNP_648309.1 Mec-17 79..189 CDD:283063 70/109 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468833
Domainoid 1 1.000 123 1.000 Domainoid score I5540
eggNOG 1 0.900 - - E1_KOG4601
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005717
OrthoInspector 1 1.000 - - otm26579
orthoMCL 1 0.900 - - OOG6_103430
Panther 1 1.100 - - P PTHR12327
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4476
SonicParanoid 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.