DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17003 and Atat1

DIOPT Version :9

Sequence 1:NP_608365.1 Gene:CG17003 / 33006 FlyBaseID:FBgn0031082 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_038954719.1 Gene:Atat1 / 361789 RGDID:1303066 Length:477 Species:Rattus norvegicus


Alignment Length:258 Identity:86/258 - (33%)
Similarity:118/258 - (45%) Gaps:78/258 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VEFAFDIKHLFPQSIIRVQAHSLRPKVTQCRRYAQTERGKSTMTSCRL---SEILNI---MGKLS 60
            :||.||:..|||:.|..:..| |||..          |...|.|..|:   .:|:.|   :||.|
  Rat     1 MEFPFDVDALFPERITVLDQH-LRPPA----------RRPGTTTPARVDLQQQIMTIVDELGKAS 54

  Fly    61 ADAQGLCHAVTSADKLASDQ-VVYLMAD---KAAGHWEITGLLKVGTKDLFVFDQGGCYRRLNQT 121
            |.||.|...:|||.::.|:: |:|::.|   :.||...|.|.||||.|.|||.|....:..: :.
  Rat    55 AKAQHLPAPITSALRMQSNRHVIYVLKDTSARPAGKGAIIGFLKVGYKKLFVLDDREAHNEV-EP 118

  Fly   122 PAILDFYVHESRQRCGQGKLLFEWMLE--------------------KQGWS------------- 153
            ..|||||:|||.||.|.|:.||::||:                    ...||             
  Rat   119 LCILDFYIHESVQRHGHGRELFQYMLQVPEIDLKGSSPRSSKRPCSMPHNWSIFLCIPLPGSQLP 183

  Fly   154 -----------------------AHKCTVDRPSNKMLAFMAKHYGLVRTIPQGNNFVLYEGFF 193
                                   .|:..:||||.|:|.|:.|||.|..|:||.||||::||||
  Rat   184 ASMLLLPPPAPKLPLFLQKERVEPHQLAIDRPSPKLLKFLNKHYNLETTVPQVNNFVIFEGFF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17003NP_608365.1 Mec-17 84..194 CDD:283063 55/169 (33%)
Atat1XP_038954719.1 Acetyltransf_16 10..246 CDD:398794 80/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352867
Domainoid 1 1.000 136 1.000 Domainoid score I4790
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005717
OrthoInspector 1 1.000 - - otm45264
orthoMCL 1 0.900 - - OOG6_103430
Panther 1 1.100 - - O PTHR12327
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.