DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17003 and atat-2

DIOPT Version :9

Sequence 1:NP_608365.1 Gene:CG17003 / 33006 FlyBaseID:FBgn0031082 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001379875.1 Gene:atat-2 / 180852 WormBaseID:WBGene00021059 Length:263 Species:Caenorhabditis elegans


Alignment Length:297 Identity:73/297 - (24%)
Similarity:122/297 - (41%) Gaps:65/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VEFAFDIKHLFPQSIIRVQAHSL---RPKVTQCRRYAQTERGKSTMTSCRLSEILNIMGKLSADA 63
            :|.|||:..:|..:|.|:....|   .||     ||            ..:::.::.:|::|:..
 Worm     1 MEIAFDLSTIFTDNIQRLTRTDLLKYGPK-----RY------------WAVAQSIDCLGEMSSKF 48

  Fly    64 QGLCHAVTSADKLA---SDQVVYLMADKAAGHWEI-TGLLKVGTKDLFVFD-QGGCYRRLNQTPA 123
            .|....:|..||:.   .:|..|:|.:|..|...| .|||:||.|.|::.| :...|  :.:...
 Worm    49 HGWKRVITMYDKIVDHDEEQTTYIMWEKVNGSKSILKGLLRVGYKTLYLTDNEQNQY--MEKAMC 111

  Fly   124 ILDFYVHESRQRCGQGKLLFEWMLEKQGWSAHKCTVDRPSNKMLAFMAKHYGLVRTIPQGNNFVL 188
            ||||:|..:.||.|.|..:|:.||:.:..:..:|..|:||..:..|:.|:|.....:.|.|.:.|
 Worm   112 ILDFFVVPTEQRSGNGFKMFDEMLKAENVTVDQCAFDKPSAALQQFLEKYYDRKDLVWQSNKYAL 176

  Fly   189 YEGFF--------DDPITTCKSASGLQATGSGCRSRSQGHYVRQEQDQAQIKHGQANRNTVQNDA 245
            ...||        ..|..|.:::....|..|...||:.               ....||..::|:
 Worm   177 CSNFFIGRHPTVPFTPRQTKRASRASSAVSSHASSRNT---------------SPIGRNRPRHDS 226

  Fly   246 NSGPFRQDQKIVVGTSI---------------YRRRW 267
            .:...|||....|...:               :||.|
 Worm   227 VADLMRQDMLAGVRAEVDPNSPTGLKNARDFGHRRIW 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17003NP_608365.1 Mec-17 84..194 CDD:283063 37/119 (31%)
atat-2NP_001379875.1 Acetyltransf_16 8..181 CDD:398794 51/191 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166390
Domainoid 1 1.000 92 1.000 Domainoid score I4802
eggNOG 1 0.900 - - E1_KOG4601
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I3846
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57219
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005717
OrthoInspector 1 1.000 - - otm14427
orthoMCL 1 0.900 - - OOG6_103430
Panther 1 1.100 - - O PTHR12327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.