DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17003 and mec-17

DIOPT Version :9

Sequence 1:NP_608365.1 Gene:CG17003 / 33006 FlyBaseID:FBgn0031082 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_501337.1 Gene:mec-17 / 177596 WormBaseID:WBGene00003178 Length:262 Species:Caenorhabditis elegans


Alignment Length:230 Identity:61/230 - (26%)
Similarity:102/230 - (44%) Gaps:38/230 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EILNIMGKLSADAQGLCHAVTSADKLA-SDQVVYLMADKAAGHWE---------ITGLLKVGTKD 105
            |.::.:.||||....|...:|:.:||. ||..:||       .|:         :.|..|||.|.
 Worm    33 EAIDNLAKLSAHCLQLRTPLTTCEKLINSDSTLYL-------SWKYDEEEKVSRLMGFAKVGRKK 90

  Fly   106 LFVFD-QGGCYRRLNQTPAILDFYVHESRQRCGQGKLLFEWMLEKQGWSAHKCTVDRPSNKMLAF 169
            ||::| |...|.  .:...:||||||.|.||.|.|:.:.::|..::....::..:|.||..:|.|
 Worm    91 LFLYDSQMQTYE--GEILCLLDFYVHFSCQRQGVGQQILDYMFSQEHTEPYQLALDNPSVTLLGF 153

  Fly   170 MAKHYGLVRTIPQGNNFVLYEGFF-----------------DDPITTCKSASGLQATGSGCRSRS 217
            |::.|||::.:.|..|||::|..|                 ..|:|..:..:|:..| ...:...
 Worm   154 MSQKYGLIKPVWQNTNFVVFEELFLALSAENGIEKPPPDGWRRPMTPRRLGTGMTDT-RWLQHAV 217

  Fly   218 QGHYVRQEQDQAQIKHGQANRNTVQNDANSGPFRQ 252
            .||..:.....|.:......:..:.|.|:....|:
 Worm   218 SGHQSKGNAMAAPVDADMTPQGALSNRAHQAKARK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17003NP_608365.1 Mec-17 84..194 CDD:283063 39/136 (29%)
mec-17NP_501337.1 Mec-17 67..177 CDD:283063 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166389
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005717
OrthoInspector 1 1.000 - - otm14232
orthoMCL 1 0.900 - - OOG6_103430
Panther 1 1.100 - - O PTHR12327
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4476
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.