DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17003 and atat1

DIOPT Version :9

Sequence 1:NP_608365.1 Gene:CG17003 / 33006 FlyBaseID:FBgn0031082 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_012823287.2 Gene:atat1 / 100038151 XenbaseID:XB-GENE-478280 Length:419 Species:Xenopus tropicalis


Alignment Length:329 Identity:101/329 - (30%)
Similarity:157/329 - (47%) Gaps:67/329 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VEFAFDIKHLFPQSIIRVQAH---SLRPKVTQCRRYAQTERGKSTMTSCRLSEILNIMGKLSADA 63
            :||.||:..:|.:.|.::.:.   |.||.:      |.:|..|..||      :::.:||.||.|
 Frog     1 MEFDFDVHKIFLEPITKLDSSLIPSRRPLI------ASSEAQKQIMT------VIDEIGKASAKA 53

  Fly    64 QGLCHAVTSADKLASDQ-VVYLMAD---KAAGHWEITGLLKVGTKDLFVFDQGGCYRRLNQTP-A 123
            |.|...:|||.::.::: .:|::.|   |.||...:.|.||||.|.|||.||.|.:  :...| .
 Frog    54 QRLPAPITSASRMQTNKHHLYILKDCTPKTAGRGAVIGFLKVGCKKLFVLDQKGSH--IEAEPLC 116

  Fly   124 ILDFYVHESRQRCGQGKLLFEWMLEKQGWSAHKCTVDRPSNKMLAFMAKHYGLVRTIPQGNNFVL 188
            |||||:||:.||.|.||.||.:||:.:....|...:||||.|.|:|:.||:.|..||||.||||:
 Frog   117 ILDFYIHETLQRHGFGKELFTFMLKNEQVDVHHLAIDRPSEKFLSFLRKHFNLWSTIPQVNNFVV 181

  Fly   189 YEGFFDDPITTCKSASGLQATGS-GCRSRSQGHYVRQEQ------DQAQI--------------- 231
            ::|||.|...:.|.....:..|. ...|.:...:::||:      .|:|:               
 Frog   182 FDGFFRDWKASVKKTPAKRTEGEIKPYSLTDRDFLKQEEGLPWPFSQSQLNLNRASSLGSSPTRA 246

  Fly   232 --KHGQANRNTVQNDANSGPFRQDQKIVVGTSIYR-----------RRWKSPRTLARAGCREVSG 283
              :|.....:.|::..|..|.          |::|           ||..|...|:|....:.:|
 Frog   247 CSRHSPGEEDFVKSLRNCRPH----------SLHRTANSEQEDHSQRRRTSAMNLSRGLMAQKNG 301

  Fly   284 GRRF 287
            ..|:
 Frog   302 YSRY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17003NP_608365.1 Mec-17 84..194 CDD:283063 54/113 (48%)
atat1XP_012823287.2 Acetyltransf_16 8..186 CDD:398794 74/191 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 140 1.000 Domainoid score I4719
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4521
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005717
OrthoInspector 1 1.000 - - otm48329
Panther 1 1.100 - - O PTHR12327
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4476
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.