DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nep3 and PHEX

DIOPT Version :10

Sequence 1:NP_523417.2 Gene:Nep3 / 33005 FlyBaseID:FBgn0031081 Length:786 Species:Drosophila melanogaster
Sequence 2:NP_000435.3 Gene:PHEX / 5251 HGNCID:8918 Length:749 Species:Homo sapiens


Alignment Length:115 Identity:20/115 - (17%)
Similarity:39/115 - (33%) Gaps:53/115 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 VRLQRDFKTNQNMSETTKKLQKKL---STSILLQIILSG--------------------VVWFVL 239
            :|:|:.. .::.:.|.::.|.:|:   |..||.::.::.                    |.|   
Human   100 IRVQKSL-LDERLKEKSQDLMQKVCNESCDILSEMEVTACADCRKFYLSCNDSTLCTARVTW--- 160

  Fly   240 YFVPWVFNEFGDPEYYTNHIVMYIILSSLVTQWYSLISVFLITWSISGFF 289
             ...||             :|::.||            :||....|.|:|
Human   161 -SYKWV-------------VVLFTIL------------MFLAVAGIGGYF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nep3NP_523417.2 M13 123..784 CDD:341056 20/115 (17%)
PHEXNP_000435.3 M13 74..740 CDD:341056 20/115 (17%)

Return to query results.
Submit another query.