DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pico and Grb14

DIOPT Version :9

Sequence 1:NP_608363.1 Gene:pico / 33003 FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_113811.2 Gene:Grb14 / 58844 RGDID:61869 Length:538 Species:Rattus norvegicus


Alignment Length:329 Identity:101/329 - (30%)
Similarity:157/329 - (47%) Gaps:23/329 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 RRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQMQSNWALVEHLGDLQMERLFEDHELL 430
            ::..:|.::.|.:|::|.|...:....|.:||..|||....::|.|.|||....:||..||||||
  Rat   104 KKQVIKVYSEDESSRALEVPSDVTARDVCQLLILKNHYVDDNSWTLFEHLSHTGVERTVEDHELL 168

  Fly   431 VDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLPGPQMAPGCQ-HDEQTRQMLLDEFFDSHNQL 494
            .:.|..|..:..|::..::...|...|..|..:.|...::...: :.:::...:...|..|:...
  Rat   169 TEVLSHWVMEEDNKLYLRKNYAKYEFFKNPMYFFPEHMVSFATEMNGDRSLTQIPQMFLSSNTYP 233

  Fly   495 QMDGPLYMKADPKKGWKRYHFVLRSSGLYYFPKEKTKNTRDLACLNLFHGHNVYTGLGWRKKWKS 559
            ::.|.|:.|...||.||:.:|.||.||||:..|..:|..|.|...:.|...|||..|..:||..:
  Rat   234 EIHGFLHAKEQGKKSWKKAYFFLRRSGLYFSTKGTSKEPRHLQFFSEFSTSNVYMSLAGKKKHGA 298

  Fly   560 PTDYTFGF---KAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIRVCKYGKQLWDS--HKSLLED 619
            ||.|.|.|   ||.|.       |.|||||||:..:...|:||||:.|||.||:.:  |.|....
  Rat   299 PTPYGFCFKPTKAGGP-------RDLKMLCAEEDQSRMCWVTAIRLLKYGMQLYQNYMHPSQARS 356

  Fly   620 LCLSRDDAVSQSSFAASMRSESISSISSAVPSQCGSVSSAISSMSNSTSGRTSRASSSSSSGCLS 684
            .|.|:.        .:.|||.|.:|:.:...|  |..:..|.:.:.:.|.......:....|||.
  Rat   357 ACSSQS--------VSPMRSVSENSLVAMDFS--GQKTRVIDNPTEALSVAVEEGLAWRKKGCLR 411

  Fly   685 DDNN 688
            ..|:
  Rat   412 LGNH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
picoNP_608363.1 GRB7_RA 364..451 CDD:176382 27/84 (32%)
PH_APBB1IP 489..614 CDD:269961 52/129 (40%)
PH 494..605 CDD:278594 46/113 (41%)
Grb14NP_113811.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73
Ubiquitin_like_fold 105..189 CDD:421700 27/83 (33%)
PH_APBB1IP 228..349 CDD:269961 52/127 (41%)
BPS 368..412 CDD:401046 10/45 (22%)
SH2_Grb14 431..538 CDD:198277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.