DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pico and Grb14

DIOPT Version :9

Sequence 1:NP_608363.1 Gene:pico / 33003 FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_057928.1 Gene:Grb14 / 50915 MGIID:1355324 Length:538 Species:Mus musculus


Alignment Length:331 Identity:100/331 - (30%)
Similarity:156/331 - (47%) Gaps:19/331 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 RRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQMQSNWALVEHLGDLQMERLFEDHELL 430
            ::..:|.::.|..|::|.|...:....|.:||..|||....::|.|.|||..:.:||..|||||.
Mouse   104 KKQVIKVYSEDETSRALEVPSDITARDVCQLLILKNHYVDDNSWTLFEHLSHIGLERTVEDHELP 168

  Fly   431 VDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLPGPQMAPGCQ-HDEQTRQMLLDEFFDSHNQL 494
            .:.|..|..:..|::..::...|...|..|..:.|...::...: :.:::...:|..|..|....
Mouse   169 TEVLSHWGVEEDNKLYLRKNYAKYEFFKNPMYFFPEHMVSFAAEMNGDRSPTQILQVFLSSSTYP 233

  Fly   495 QMDGPLYMKADPKKGWKRYHFVLRSSGLYYFPKEKTKNTRDLACLNLFHGHNVYTGLGWRKKWKS 559
            ::.|.|:.|...||.||:.:|.||.||||:..|..:|..|.|...:.|...:||..|..:||..:
Mouse   234 EIHGFLHAKEQGKKSWKKAYFFLRRSGLYFSTKGTSKEPRHLQLFSEFSTSHVYMSLAGKKKHGA 298

  Fly   560 PTDYTFGF---KAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIRVCKYGKQLWDSHKSLLEDLC 621
            ||.|.|..   ||.|.       |.|||||||:..:...|:||||:.|.|.||:.::....:   
Mouse   299 PTPYGFCLKPNKAGGP-------RDLKMLCAEEEQSRTCWVTAIRLLKDGMQLYQNYMHPYQ--- 353

  Fly   622 LSRDDAVSQSSFAASMRSESISSISSAVPSQCGSVSSAISSMSNSTSGRTSRASSSSSSGCLSDD 686
             .|....|||  .:.|||.|.:|:.:...|  |..|..|.:.:.:.|.......:....|||...
Mouse   354 -GRSACNSQS--MSPMRSVSENSLVAMDFS--GEKSRVIDNPTEALSVAVEEGLAWRKKGCLRLG 413

  Fly   687 NNAFDS 692
            |:...|
Mouse   414 NHGSPS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
picoNP_608363.1 GRB7_RA 364..451 CDD:176382 26/84 (31%)
PH_APBB1IP 489..614 CDD:269961 49/127 (39%)
PH 494..605 CDD:278594 44/113 (39%)
Grb14NP_057928.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
GRB7_RA 104..188 CDD:176382 26/83 (31%)
PH_APBB1IP 228..349 CDD:269961 49/127 (39%)
PH 233..339 CDD:278594 44/112 (39%)
BPS 368..412 CDD:286088 11/45 (24%)
SH2_Grb14 431..538 CDD:198277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847710
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.