DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pico and Y37D8A.4

DIOPT Version :9

Sequence 1:NP_608363.1 Gene:pico / 33003 FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_499670.1 Gene:Y37D8A.4 / 176699 WormBaseID:WBGene00012546 Length:227 Species:Caenorhabditis elegans


Alignment Length:180 Identity:35/180 - (19%)
Similarity:70/180 - (38%) Gaps:51/180 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   961 VLPQRSPSTTLSCH-----SSSSAGSAYQTYAPGPMLPPRADVA---RLSSLSNGSSSEVTS-PK 1016
            :||:|..|..|. |     ||..|...|::::.|.::.|....|   ....:..|::...:| |.
 Worm     4 LLPRRRFSALLD-HIKNWTSSIRADKQYRSFSTGDLVSPSQPSAFEPDFMEMEFGATPTTSSLPS 67

  Fly  1017 RLQESASNPPRDFLKDLQRVMRKKWQVAQKCKAEPATTPHEVLGFRDFSN---EDLLAAHN---- 1074
            ...:: ...|.:|.|...:::.:..:.|:|.|        :...|.:.|.   ||:..|.:    
 Worm    68 HFDDN-DLVPVEFKKSGVKLIPQGTRKAEKAK--------KFGSFEELSKVKLEDIHRAQSWFFV 123

  Fly  1075 -----------LNSGANSSHY-------------YRETANVSHWVRKHYE 1100
                       :::|.:.|.:             :|:| .|.|.|.::|:
 Worm   124 DVDPKSAERILMSNGFSDSSFLISFFRQKYVLSIWRKT-KVEHLVIRNYQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
picoNP_608363.1 GRB7_RA 364..451 CDD:176382
PH_APBB1IP 489..614 CDD:269961
PH 494..605 CDD:278594
Y37D8A.4NP_499670.1 SH2 118..202 CDD:214585 8/56 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.