DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment THADA and thada

DIOPT Version :9

Sequence 1:NP_608361.3 Gene:THADA / 33001 FlyBaseID:FBgn0031077 Length:1746 Species:Drosophila melanogaster
Sequence 2:NP_001013501.1 Gene:thada / 541356 ZFINID:ZDB-GENE-050320-49 Length:364 Species:Danio rerio


Alignment Length:242 Identity:59/242 - (24%)
Similarity:86/242 - (35%) Gaps:74/242 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1403 LHIVEDLAETIWALDELKVEL---------WLYILLQRSLSEQNS-------------------- 1438
            ||.:..|..|:.|.:.||..:         ||...:.|.|||..|                    
Zfish    83 LHTLSFLYITLPAKNPLKRAVSSALGSGPDWLQEQMVRCLSEGLSAAFSSASTDHFSNLTDSITS 147

  Fly  1439 -----LVSEQDIEHF------EFSRDIRRYFETLSREQREEVGQEL-------YESPAVRSSVLH 1485
                 |:.|:.:.|.      .|.:.:..|.|    :.|..||..:       |...||::|:|.
Zfish   148 CLSGFLIGEKCVHHLLTEVLQFFQKALNYYVE----QNRILVGCHVAQAQLMQYSLAAVKASMLV 208

  Fly  1486 MMH---------MIKSSKNSCWSLQLAGRLAALQTLLRDPGLELNQLVQRCSEEHSTHQEAGLLL 1541
            :..         :..||..|.....|:|.|.....:|.|.  |..|.||      ||...|.:||
Zfish   209 VQQSQEPISAAVLSASSDQSDLYQALSGLLNCYTCVLTDE--EFVQAVQ------STAGMAAVLL 265

  Fly  1542 GLRRLIGESKMLERKHWLPMLNYAQRLVHPGQ-PVYLRHQAAELCDS 1587
             :|.|:|....|   |:: :....|..|..|. |.:||...|.|.:|
Zfish   266 -IRSLLGNGDNL---HFI-VAGLLQCSVDAGSTPQWLRKSCAGLYES 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
THADANP_608361.3 DUF2428 863..1112 CDD:313558
thadaNP_001013501.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596122
Domainoid 1 1.000 157 1.000 Domainoid score I4126
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D18527at33208
OrthoFinder 1 1.000 - - FOG0002253
OrthoInspector 1 1.000 - - oto41456
orthoMCL 1 0.900 - - OOG6_102243
Panther 1 1.100 - - O PTHR14387
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2009
SonicParanoid 1 1.000 - - X2730
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.