DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hers and SHL1

DIOPT Version :9

Sequence 1:NP_001245771.1 Gene:Hers / 33000 FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:NP_568053.1 Gene:SHL1 / 830065 AraportID:AT4G39100 Length:228 Species:Arabidopsis thaliana


Alignment Length:136 Identity:37/136 - (27%)
Similarity:62/136 - (45%) Gaps:18/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  2361 MRHVEGDIIRIRDCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDC 2425
            ::|:... |:..|.||::::|..:..|||:|..:..:.......:.:.||||||.:..||::...
plant    16 LKHINKS-IQEGDAVLMRSSEPGKPSYVARVEAIETDARGSHAKVRVRWYYRPEESIGGRRQFHG 79

  Fly  2426 PDEVYASRHRDHNSVACVEDKCYVLTFSEY------------CRYRRRLRAAEEDVEDVSI---- 2474
            ..||:.|.|.|..|...:|.||.|.:||.|            ||:.........|.:.|::    
plant    80 AKEVFLSDHFDFQSADTIEGKCKVHSFSSYTKLDSVGNDDFFCRFEYNSTTGAFDPDRVTVFCKC 144

  Fly  2475 -VPRRP 2479
             :|..|
plant   145 EMPYNP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 36/131 (27%)
SHL1NP_568053.1 BAH 23..157 CDD:413397 36/128 (28%)
PHD_SF 141..187 CDD:419867 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3939
eggNOG 1 0.900 - - E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2611
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.