DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hers and AT4G04260

DIOPT Version :9

Sequence 1:NP_001245771.1 Gene:Hers / 33000 FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:NP_001328826.1 Gene:AT4G04260 / 825742 AraportID:AT4G04260 Length:206 Species:Arabidopsis thaliana


Alignment Length:85 Identity:29/85 - (34%)
Similarity:46/85 - (54%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  2373 DCVLLKANEDNELPYVAKVAHLWQNPEDGEMMMSLLWYYRPEHTDQGRQRNDCPDEVYASRHRDH 2437
            ||||::.::..:.||||:|..:..:..: .:.:...|||.||.:..||::.....|::.|.|.|.
plant    10 DCVLMRPSDAGKAPYVARVEKIEADARN-NVKVHCRWYYCPEESHGGRRQLHGAKELFLSDHFDV 73

  Fly  2438 NSVACVEDKCYVLTFSEYCR 2457
            .|...:|.||.|.||..|.|
plant    74 QSAHTIEGKCIVHTFKNYTR 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HersNP_001245771.1 BAH_BAHCC1 2366..2519 CDD:240065 29/85 (34%)
AT4G04260NP_001328826.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3939
eggNOG 1 0.900 - - E1_KOG1886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2611
orthoMCL 1 0.900 - - OOG6_107965
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.