DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hers and Hers

DIOPT Version :10

Sequence 1:NP_608360.2 Gene:Hers / 33000 FlyBaseID:FBgn0052529 Length:2529 Species:Drosophila melanogaster
Sequence 2:XP_061498715.1 Gene:Hers / 1274591 VectorBaseID:AGAMI1_009884 Length:3503 Species:Anopheles gambiae


Alignment Length:128 Identity:31/128 - (24%)
Similarity:50/128 - (39%) Gaps:32/128 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 MATISIEKEAN-QLAKI--SDLLQEPAE------LCPKPPPM-SPTKSIH----SNQSSPIKSDG 148
            :.|:|::..|| ::.:|  :|.|...||      |..||..: .|.|...    :...||:.:. 
Mosquito   149 LETVSLQLHANVRIRRIYFADKLYTEAELPNDYRLMGKPKDLKKPEKQFKVQATARPPSPLNTG- 212

  Fly   149 YSSENSNEQDSSFETTTEET----------------PLPEKSPPKAVETPMKTIGKEKAPPSE 195
             ..|....:|:..|.|...|                |:|:|.|..|...|.:...:|.||.:|
Mosquito   213 -RGEPGPSKDTDAEATGPATDPMSEPEPALQKSPSPPVPQKVPSPAASAPPEPATEEPAPQTE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HersNP_608360.2 BAH_BAHCC1 2366..2519 CDD:240065
HersXP_061498715.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.