DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB2 and CG5504

DIOPT Version :9

Sequence 1:NP_006727.2 Gene:DNAJB2 / 3300 HGNCID:5228 Length:324 Species:Homo sapiens
Sequence 2:NP_995932.1 Gene:CG5504 / 48844 FlyBaseID:FBgn0002174 Length:520 Species:Drosophila melanogaster


Alignment Length:430 Identity:108/430 - (25%)
Similarity:166/430 - (38%) Gaps:126/430 - (29%)


- Green bases have known domain annotations that are detailed below.


Human     4 YYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68
            ||..|.|.::|:..||||||.:.|.::|||.|.::.: |.:||:||:||||||||:.||..||.|
  Fly    66 YYATLGVAKNANGKDIKKAYYQLAKKYHPDTNKEDPD-AGRKFQEVSEAYEVLSDEQKRREYDTY 129

Human    69 GR--EGLTGTGTG-PSRAEAGSGGPGF--TFTFRS---PEEVFREFFGSGDPFAELFDDLGP--- 122
            |:  |.:...|.| |.....|.|..||  ::.|||   |||:||:.||.|:.....|||...   
  Fly   130 GQTAENIGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFADSKF 194

Human   123 -FSELQNRGSRHSGPFFTFSSSFPG-HSDFSSSSFSFSP--------------------GAGAFR 165
             |.:.|.....     .||:.:..| :.|.:.:.....|                    |.| |.
  Fly   195 GFGQAQEMVMD-----LTFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPGRCQYCNGTG-FE 253

Human   166 SVSTSTTFV------------------------QGRRITTRRI-------MENGQ---------- 189
            :|||. .||                        :||.:..|::       :||||          
  Fly   254 TVSTG-PFVMRSTCRYCQGTRQHIKYPCSECEGKGRTVQRRKVTVPVPAGIENGQTVRMQVGSKE 317

Human   190 ---------------ERVEVEEDGQLK--------SVTINGVPDDLALGLE---------LSRRE 222
                           |..:|..|..:.        :|.:.||.:|..:.:|         :.|.:
  Fly   318 LFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVYEDQWINVEPGTSSHHKIMLRGK 382

Human   223 QQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRP 287
            ....|.:...|........:.|....|.:.   :||:..:.:|:|.  ..|.......:|:.|..
  Fly   383 GLKRVNAHGHGDHYVHVKITVPSAKKLDKK---RLALIEAYAELEE--DTPGQIHGIANRKDGSK 442

Human   288 KA---QHQDPGLGGTQE----GARGEATKRSPSPEEKASR 320
            :|   ..::||.|...:    .|...|:|..|..|:...:
  Fly   443 QATAGASEEPGAGAAAKASAAAAGSGASKPGPGAEKSEGK 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB2NP_006727.2 DnaJ 3..>110 CDD:223560 53/113 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..90 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..324 21/110 (19%)
CAAX motif. /evidence=ECO:0000269|PubMed:12754272 321..324 108/430 (25%)
CG5504NP_995932.1 DnaJ 63..437 CDD:223560 97/383 (25%)
DnaJ 65..127 CDD:278647 31/61 (51%)
DnaJ_zf 227..287 CDD:199908 9/61 (15%)
DnaJ_C 288..409 CDD:199909 18/120 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.