DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB2 and CG3061

DIOPT Version :9

Sequence 1:NP_006727.2 Gene:DNAJB2 / 3300 HGNCID:5228 Length:324 Species:Homo sapiens
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:124 Identity:47/124 - (37%)
Similarity:62/124 - (50%) Gaps:24/124 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     4 YYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68
            |||:|.|.::|:..:|||||::.|||.|||||  ....|.:.||.:..|..||:|..||:.||.|
  Fly   107 YYEVLGVSKTATDSEIKKAYKKLALQLHPDKN--KAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169

Human    69 G-REGLTGTGTGPSRAEAGSGGP-----------GFTFTFR---SPEEVFREFFGSGDP 112
            | .|...|.|.       ..||.           |::..|:   |.||:|..||..|.|
  Fly   170 GINESHNGHGN-------NGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB2NP_006727.2 DnaJ 3..>110 CDD:223560 45/120 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..90 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..324
CAAX motif. /evidence=ECO:0000269|PubMed:12754272 321..324
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 47/124 (38%)
DnaJ 106..167 CDD:278647 28/61 (46%)
DUF1977 269..366 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154079
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.