DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB2 and CG3061

DIOPT Version :10

Sequence 1:NP_006727.2 Gene:DNAJB2 / 3300 HGNCID:5228 Length:324 Species:Homo sapiens
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:44 Identity:11/44 - (25%)
Similarity:20/44 - (45%) Gaps:10/44 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   128 KSDSDSLERRLPNTFCGENM--LMEHYPSSWSKVIEIWFNESKY 169
            |:|..||::.:...:.|:|:  :..|.|.:        .|..||
  Fly    45 KNDRISLKKIMSLAYKGQNIIKMCVHLPRN--------SNAGKY 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB2NP_006727.2 PRK10767 4..>136 CDD:236757 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..324
CAAX motif. /evidence=ECO:0000269|PubMed:12754272 321..324
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090
DUF1977 264..364 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.