DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DNAJB2 and P58IPK

DIOPT Version :9

Sequence 1:	NP_006727.2	Gene:	DNAJB2 / 3300	HGNCID:	5228	Length:	324	Species:	Homo sapiens
Sequence 2:	NP_649916.1	Gene:	P58IPK / 41161	FlyBaseID:	FBgn0037718	Length:	498	Species:	Drosophila melanogaster

Alignment Length:	111	Identity:	46/111 - (41%)
Similarity:	57/111 - (51%)	Gaps:	17/111 - (15%)

- Green bases have known domain annotations that are detailed below.

Human     4 YYEILDVPRSASADDIKKAYRRKALQWHPDK-NPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDR 67
            ||:||.|.||||..:|.||||:.|.:||||. ..:.|:.|||||.::|.|.|||:|..||..:|
  Fly   397 YYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQFD- 460

Human    68 YGREGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPF 113
                    .|..|...|:...| ||     ..|..|.. |..|.||
  Fly   461 --------NGEDPLDPESNQRG-GF-----HGEHPFGH-FQHGSPF 491

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DNAJB2	NP_006727.2	DnaJ	3..>110	CDD:223560	43/106 (41%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	70..90		3/19 (16%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	218..324
		CAAX motif. /evidence=ECO:0000269\|PubMed:12754272	321..324
P58IPK	NP_649916.1	TPR_11	42..108	CDD:290150
		TPR repeat	43..71	CDD:276809
		TPR repeat	76..106	CDD:276809
		TPR_11	78..142	CDD:290150
		TPR repeat	111..139	CDD:276809
		TPR_1	113..144	CDD:278916
		TPR_19	167..234	CDD:291240
		TPR repeat	190..220	CDD:276809
		TPR repeat	225..253	CDD:276809
		TPR repeat	309..337	CDD:276809
		TPR_11	312..373	CDD:290150
		TPR repeat	341..371	CDD:276809
		TPR repeat	376..399	CDD:276809	1/1 (100%)
		DnaJ	395..>485	CDD:223560	42/103 (41%)
		DnaJ	396..460	CDD:278647	33/62 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910