powered by:
Protein Alignment DNAJB2 and CG7130
DIOPT Version :9
Sequence 1: | NP_006727.2 |
Gene: | DNAJB2 / 3300 |
HGNCID: | 5228 |
Length: | 324 |
Species: | Homo sapiens |
Sequence 2: | NP_649380.1 |
Gene: | CG7130 / 40450 |
FlyBaseID: | FBgn0037151 |
Length: | 128 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 42/70 - (60%) |
Similarity: | 58/70 - (82%) |
Gaps: | 2/70 - (2%) |
- Green bases have known domain annotations that are detailed below.
Human 4 YYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68
||:||.:.|:||::|:||.|||.||::||||| |:.: ||::|:||..|:|||.||.||||||::
Fly 5 YYKILGIERNASSEDVKKGYRRMALRYHPDKN-DHPQ-AEEQFREVVAAFEVLFDKEKREIYDQH 67
Human 69 GREGL 73
|.|||
Fly 68 GEEGL 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X251 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.