DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB2 and CG32640

DIOPT Version :9

Sequence 1:NP_006727.2 Gene:DNAJB2 / 3300 HGNCID:5228 Length:324 Species:Homo sapiens
Sequence 2:NP_727674.1 Gene:CG32640 / 318135 FlyBaseID:FBgn0052640 Length:132 Species:Drosophila melanogaster


Alignment Length:130 Identity:40/130 - (30%)
Similarity:56/130 - (43%) Gaps:2/130 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     4 YYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68
            ||.||.|..:|:.::|::||:|.||.:|||||...:..|:  |:::.||:.||||...|..||..
  Fly     5 YYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ--FRKINEAFNVLSDASARRKYDAS 67

Human    69 GREGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDLGPFSELQNRGSRH 133
            .........|..|....|....|.........:.|......|.....||...|.|..|....:.|
  Fly    68 VMLSRRAHTTNNSHNSGGYQPNGSYEREMKTSDTFSTVCAVGGVLVGLFLGFGAFKALSGSNNNH 132

Human   134  133
              Fly   133  132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB2NP_006727.2 DnaJ 3..>110 CDD:223560 33/105 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..90 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..324
CAAX motif. /evidence=ECO:0000269|PubMed:12754272 321..324
CG32640NP_727674.1 DnaJ 4..65 CDD:278647 26/61 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.