DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SKP1

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_010615.3 Gene:SKP1 / 851928 SGDID:S000002736 Length:194 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:65/200 - (32%)
Similarity:91/200 - (45%) Gaps:49/200 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTIKLESSEGVIFPTEVRVAMVSETIKTML----------------------DHFAVQN--- 40
            |||..:.|.|.||..|..:.::|..|..:|..|                      :|.:..|   
Yeast     1 MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNG 65

  Fly    41 ------DENAIVPLHSVSTFTLGKILAWANHHKD------DDDQSTEGEELKPRRPYAISPWDAI 93
                  |:..::|:.:|.:..|.|::.||.||:|      |||.|        |:...:..||..
Yeast    66 DDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDS--------RKSAPVDSWDRE 122

  Fly    94 FLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIRGKTPEEIRFIFNIPEDVSPSVDGELR-- 156
            ||.|:...|.||||||..|.||.||:....|||.||||::|||||..|||..|.:|..:..:|  
Yeast   123 FLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRE 187

  Fly   157 --WKD 159
              |.:
Yeast   188 NEWAE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 61/189 (32%)
BTB 6..114 CDD:295341 39/144 (27%)
Skp1 88..156 CDD:279768 34/67 (51%)
SKP1NP_010615.3 SKP1 3..194 CDD:227528 63/197 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344319
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.760

Return to query results.
Submit another query.