DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SKP1

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_565123.1 Gene:SKP1 / 843928 AraportID:AT1G75950 Length:160 Species:Arabidopsis thaliana


Alignment Length:156 Identity:62/156 - (39%)
Similarity:86/156 - (55%) Gaps:4/156 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANH 65
            |....|.|:||:|..|..|..||:.|:||..|::...|.|.    |||.:|::..|.|::.:...
plant     1 MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNG----VPLPNVTSKILAKVIEYCKR 61

  Fly    66 HKDDDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIR 130
            |.:......|..|........:..|||.|:.::..||.|:||||..|.||.||:||...||:||:
plant    62 HVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIK 126

  Fly   131 GKTPEEIRFIFNIPEDVSPSVDGELR 156
            ||||||||..|||..|.:|..:.|:|
plant   127 GKTPEEIRTTFNIKNDFTPEEEEEVR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 60/152 (39%)
BTB 6..114 CDD:295341 36/107 (34%)
Skp1 88..156 CDD:279768 36/67 (54%)
SKP1NP_565123.1 BTB_POZ_SKP1 5..125 CDD:349631 44/123 (36%)
Skp1 111..158 CDD:396171 24/42 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.