DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SK18

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_563864.2 Gene:SK18 / 837562 AraportID:AT1G10230 Length:158 Species:Arabidopsis thaliana


Alignment Length:157 Identity:55/157 - (35%)
Similarity:81/157 - (51%) Gaps:9/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANH 65
            |.:..|.|.||:|..|..:..||.....|..|::    .|.....:||.:|:...|.||:.:|..
plant     1 MSSNKILLTSSDGESFEIDEAVARKFLIIVHMME----DNCAGEAIPLENVTGDILSKIIEYAKM 61

  Fly    66 HKDDDDQSTEGEELKPRRPYAISPWDAIFL-MVNSTTLLEIILAAKQLQIKGLLELTYNVVANMI 129
            |.::..:..|.||.|..    :..|||.|: .::..|:.:|||||..|..:|||......||:.|
plant    62 HVNEPSEEDEDEEAKKN----LDSWDAKFMEKLDLETIFKIILAANYLNFEGLLGFASQTVADYI 122

  Fly   130 RGKTPEEIRFIFNIPEDVSPSVDGELR 156
            :.|||||:|.||||..|.:|..:.|:|
plant   123 KDKTPEEVREIFNIENDFTPEEEEEIR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 53/153 (35%)
BTB 6..114 CDD:295341 34/108 (31%)
Skp1 88..156 CDD:279768 30/68 (44%)
SK18NP_563864.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.