DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and AT5G42190

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_568603.1 Gene:AT5G42190 / 834224 AraportID:AT5G42190 Length:171 Species:Arabidopsis thaliana


Alignment Length:169 Identity:61/169 - (36%)
Similarity:91/169 - (53%) Gaps:30/169 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANHHKDDD 70
            |.|:||:|..|..:..||:.|:|||.|::.....|.    :||.:|::..|.|::.:...|.:..
plant     7 ITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNG----IPLPNVTSKILSKVIEYCKRHVEAA 67

  Fly    71 DQS------------------TEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGL 117
            ::|                  :..|:||        .||:.|:.|:..||.::||||..|.||||
plant    68 EKSETTADAAAATTTTTVASGSSDEDLK--------TWDSEFIKVDQGTLFDLILAANYLNIKGL 124

  Fly   118 LELTYNVVANMIRGKTPEEIRFIFNIPEDVSPSVDGELR 156
            |:||...||:||:||||||||..|||..|.:|..:.|:|
plant   125 LDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 60/167 (36%)
BTB 6..114 CDD:295341 35/125 (28%)
Skp1 88..156 CDD:279768 36/67 (54%)
AT5G42190NP_568603.1 BTB_POZ_SKP1 6..136 CDD:349631 44/140 (31%)
Skp1 122..169 CDD:396171 25/42 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.