DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SK11

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_567959.1 Gene:SK11 / 829569 AraportID:AT4G34210 Length:152 Species:Arabidopsis thaliana


Alignment Length:161 Identity:60/161 - (37%)
Similarity:87/161 - (54%) Gaps:16/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANH 65
            |.:..|.|.||:|..|..|..||:.|:||..|::...|.:.    :||.:|.:..|.|::.:...
plant     1 MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADG----IPLANVESKILVKVIEYCKK 61

  Fly    66 HKDDDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIR 130
            |..|:......|:|        :.||..|:.:..:|:.|:||||..|.||.||:||...||:||:
plant    62 HHVDEANPISEEDL--------NNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADMIK 118

  Fly   131 GKTPEEIRFIFNIPEDVSP----SVDGELRW 157
            ||||||||..|||..|.:|    :|..|.:|
plant   119 GKTPEEIRSTFNIENDFTPEEEEAVRKENQW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 58/156 (37%)
BTB 6..114 CDD:295341 33/107 (31%)
Skp1 88..156 CDD:279768 35/71 (49%)
SK11NP_567959.1 Skp1 3..102 CDD:214704 33/110 (30%)
SKP1 5..150 CDD:227528 59/157 (38%)
Skp1 78..150 CDD:279768 36/72 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.