DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SK13

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_567090.1 Gene:SK13 / 825171 AraportID:AT3G60010 Length:154 Species:Arabidopsis thaliana


Alignment Length:154 Identity:56/154 - (36%)
Similarity:83/154 - (53%) Gaps:15/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANHHKDDD 70
            :.|.||:|..|..|..||:.|:||..|::...|.|.    ||:.:|:...|.|::.:...|...|
plant     5 VMLLSSDGESFQVEEAVAVQSQTIAHMIEDDCVANG----VPIANVTGVILSKVIEYCKKHVVSD 65

  Fly    71 DQSTEG-EELKPRRPYAISPWDAIFL--MVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIRGK 132
            ..:.|. :|||        .|||.|:  :..|:||.:::|||..|.||.||:|....||:||.||
plant    66 SPTEESKDELK--------KWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGK 122

  Fly   133 TPEEIRFIFNIPEDVSPSVDGELR 156
            .|:|||.:..|..|.:|..:.|:|
plant   123 KPDEIRALLGIENDFTPEEEEEIR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 55/152 (36%)
BTB 6..114 CDD:295341 36/110 (33%)
Skp1 88..156 CDD:279768 30/69 (43%)
SK13NP_567090.1 BTB_POZ_SKP1 4..119 CDD:349631 43/125 (34%)
Skp1 105..152 CDD:396171 19/42 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.