DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SK15

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_566773.1 Gene:SK15 / 822152 AraportID:AT3G25650 Length:177 Species:Arabidopsis thaliana


Alignment Length:160 Identity:57/160 - (35%)
Similarity:86/160 - (53%) Gaps:10/160 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANH 65
            |.:..|.|.||:|..|..|..||...:.:|.:|:...|.|:    :||.:|:...|..:|.:...
plant     1 MSSNKIVLTSSDGESFQVEEVVARKLQIVKHLLEDDCVINE----IPLQNVTGNILSIVLEYCKK 61

  Fly    66 HKD---DDDQSTEGEELKP--RRPYAISPWDAIFLM-VNSTTLLEIILAAKQLQIKGLLELTYNV 124
            |.|   |||.|.|.::.||  .....:..|||.|:. ::..|:.::||||..|.::|||.||...
plant    62 HVDDVVDDDASEEPKKKKPDDEAKQNLDAWDAEFMKNIDMETIFKLILAANYLNVEGLLGLTCQT 126

  Fly   125 VANMIRGKTPEEIRFIFNIPEDVSPSVDGE 154
            ||:.|:.|||||:|.:|||..|.:...:.|
plant   127 VADYIKDKTPEEVRELFNIENDFTHEEEEE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 56/158 (35%)
BTB 6..114 CDD:295341 37/113 (33%)
Skp1 88..156 CDD:279768 29/68 (43%)
SK15NP_566773.1 SKP1 3..165 CDD:227528 56/158 (35%)
Skp1 3..116 CDD:214704 37/116 (32%)
Skp1 89..165 CDD:279768 29/68 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.