DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SK10

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_566695.1 Gene:SK10 / 821740 AraportID:AT3G21860 Length:152 Species:Arabidopsis thaliana


Alignment Length:161 Identity:51/161 - (31%)
Similarity:73/161 - (45%) Gaps:16/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANH 65
            |.|..|.|:||:|..|..|...|...:||..|.:.....|.    :||..|:...|..::.:.|.
plant     1 MSTKKIILKSSDGHSFEVEEEAACQCQTIAHMSEDDCTDNG----IPLPEVTGKILEMVIEYCNK 61

  Fly    66 HKDDDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIR 130
            |..|.......|:||        .||..|:....:|:.::|:||..|.||.||:|....||:||:
plant    62 HHVDAANPCSDEDLK--------KWDKEFMEKYQSTIFDLIMAANYLNIKSLLDLACQTVADMIK 118

  Fly   131 GKTPEEIRFIFNIPEDVS----PSVDGELRW 157
            ..|.|..|..|||..|.:    .:|..|.:|
plant   119 DNTVEHTRKFFNIENDYTHEEEEAVRRENQW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 49/156 (31%)
BTB 6..114 CDD:295341 30/107 (28%)
Skp1 88..156 CDD:279768 26/71 (37%)
SK10NP_566695.1 SKP1 3..149 CDD:227528 49/157 (31%)
Skp1 4..102 CDD:214704 30/109 (28%)
Skp1 76..149 CDD:279768 27/80 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.980

Return to query results.
Submit another query.