DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SK8

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_566692.1 Gene:SK8 / 821737 AraportID:AT3G21830 Length:152 Species:Arabidopsis thaliana


Alignment Length:163 Identity:51/163 - (31%)
Similarity:76/163 - (46%) Gaps:26/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWAN- 64
            |.|..|.|:||||..|..|...|...:||..|::   .:..:|.|:.|...|.. |..::.:.| 
plant     1 MSTKKIMLKSSEGKTFEIEEETARQCQTIAHMIE---AECTDNVILVLKMTSEI-LEMVIEYCNK 61

  Fly    65 HHKD------DDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYN 123
            ||.|      |||               :..||..|:..:.:|:..:..||..|..|.||.|...
plant    62 HHVDAANPCSDDD---------------LEKWDKEFMEKDKSTIFALTNAANFLNNKSLLHLAGQ 111

  Fly   124 VVANMIRGKTPEEIRFIFNIPEDVSPSVDGELR 156
            .||:||:|.||:::|..|||..|::|..:..:|
plant   112 TVADMIKGNTPKQMREFFNIENDLTPEEEAAIR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 49/159 (31%)
BTB 6..114 CDD:295341 31/114 (27%)
Skp1 88..156 CDD:279768 24/67 (36%)
SK8NP_566692.1 SKP1 3..150 CDD:227528 50/161 (31%)
Skp1 4..101 CDD:214704 30/115 (26%)
Skp1 77..150 CDD:279768 25/68 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.980

Return to query results.
Submit another query.