DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SK20

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001078065.1 Gene:SK20 / 819203 AraportID:AT2G45950 Length:352 Species:Arabidopsis thaliana


Alignment Length:144 Identity:45/144 - (31%)
Similarity:72/144 - (50%) Gaps:12/144 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPL-HSVSTFTLGKILAWANHHKDD 69
            |.|::::|.|...|..|||....|...:....|.:.:|..:.| ..|:......||.:...|:  
plant    18 IWLQTADGSIQQVEQEVAMFCPMICQEVIQKGVGSSKNHAISLPQRVNPAMFSLILDYCRFHQ-- 80

  Fly    70 DDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIRGKTP 134
                ..|...|.|:.|     |..|:.:::..|.|:..||..||:|.|::||...:|.:|.||.|
plant    81 ----LPGRSNKERKTY-----DERFIRMDTKRLCELTSAADSLQLKPLVDLTSRALARIIEGKNP 136

  Fly   135 EEIRFIFNIPEDVS 148
            ||||.||::|:|::
plant   137 EEIREIFHLPDDLT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 45/144 (31%)
BTB 6..114 CDD:295341 27/108 (25%)
Skp1 88..156 CDD:279768 25/61 (41%)
SK20NP_001078065.1 Skp1 15..116 CDD:214704 27/108 (25%)
Skp1 90..153 CDD:279768 26/66 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.