DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SK3

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_565604.1 Gene:SK3 / 817111 AraportID:AT2G25700 Length:163 Species:Arabidopsis thaliana


Alignment Length:160 Identity:60/160 - (37%)
Similarity:86/160 - (53%) Gaps:21/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANHHKD-- 68
            |.|:||:|..|..|..||:.|:|||.|::...|.|.    :||.:|:...|.|::.:...|.:  
plant     8 IILKSSDGESFEVEEAVAVESQTIKHMIEDDCVDNG----IPLPNVTGAILAKVIEYCKKHVEAA 68

  Fly    69 -----DDD--QSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVA 126
                 |.|  .|||..|||        .||..|:.|:..||.:::.||..|.|.|||:||...||
plant    69 AEAGGDKDFYGSTENHELK--------TWDNDFVKVDHPTLFDLLRAANYLNISGLLDLTCKAVA 125

  Fly   127 NMIRGKTPEEIRFIFNIPEDVSPSVDGELR 156
            :.:|||||.::|..|||..|.:|..:.|:|
plant   126 DQMRGKTPAQMREHFNIKNDYTPEEEAEVR 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 59/158 (37%)
BTB 6..114 CDD:295341 39/116 (34%)
Skp1 88..156 CDD:279768 29/67 (43%)
SK3NP_565604.1 BTB_POZ_SKP1 7..128 CDD:349631 47/131 (36%)
Skp1 115..161 CDD:396171 20/41 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.980

Return to query results.
Submit another query.