DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and MEO

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_565467.1 Gene:MEO / 816536 AraportID:AT2G20160 Length:150 Species:Arabidopsis thaliana


Alignment Length:162 Identity:47/162 - (29%)
Similarity:73/162 - (45%) Gaps:20/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENA--IVPLHSVSTFTLGKILAWA 63
            |.:..|.|.||:...|..:..||...:.:..|:|      |:.|  .:.|.:|:...|..|:.:.
plant     1 MSSKKIVLTSSDDECFEIDEAVARKMQMVAHMID------DDCADKAIRLQNVTGKILAIIIEYC 59

  Fly    64 NHHKDDDDQSTEGEELKPRRPYAISPWDAIFLM-VNSTTLLEIILAAKQLQIKGLLELTYNVVAN 127
            ..|.||.:...|           ...|||.|:. ::..||.:::.||..|.:.||..|....:|:
plant    60 KKHVDDVEAKNE-----------FVTWDAEFVKNIDMDTLFKLLDAADYLIVIGLKNLIAQAIAD 113

  Fly   128 MIRGKTPEEIRFIFNIPEDVSPSVDGELRWKD 159
            ....||..|||.:|||..|.:|..:.|||.|:
plant   114 YTADKTVNEIRELFNIENDYTPEEEEELRKKN 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 43/155 (28%)
BTB 6..114 CDD:295341 28/110 (25%)
Skp1 88..156 CDD:279768 24/68 (35%)
MEONP_565467.1 BTB_POZ_SKP1 5..114 CDD:349631 32/125 (26%)
Skp1 102..148 CDD:396171 18/44 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.