DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SK16

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_565297.1 Gene:SK16 / 814848 AraportID:AT2G03190 Length:170 Species:Arabidopsis thaliana


Alignment Length:165 Identity:51/165 - (30%)
Similarity:81/165 - (49%) Gaps:15/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENA--IVPLHSVSTFTLGKILAWA 63
            |.:..|.|.||:...|..|..||...:.|..|:|      |:.|  .:||.:|:...|..::.:.
plant     1 MSSNKIVLTSSDDESFEVEEAVARKLKVIAHMID------DDCADKAIPLENVTGNILALVIEYC 59

  Fly    64 NHH----KDDDDQSTE--GEELKPRRPYAISPWDAIFLM-VNSTTLLEIILAAKQLQIKGLLELT 121
            ..|    .||.|.|||  .|.:.......:..|||.|:. .:..|::::|||...|.::.||.||
plant    60 KKHVLDDVDDSDDSTEATSENVNEEAKNELRTWDAEFMKEFDMETVMKLILAVNYLNVQDLLGLT 124

  Fly   122 YNVVANMIRGKTPEEIRFIFNIPEDVSPSVDGELR 156
            ...||:.::..:|||:|.:|||..|.:|..:..:|
plant   125 CQTVADHMKDMSPEEVRELFNIENDYTPEEEDAIR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 49/161 (30%)
BTB 6..114 CDD:295341 34/116 (29%)
Skp1 88..156 CDD:279768 24/68 (35%)
SK16NP_565297.1 SKP1 3..165 CDD:227528 50/163 (31%)
Skp1 3..117 CDD:214704 34/119 (29%)
Skp1 92..165 CDD:279768 25/68 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.