DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SK14

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_565296.1 Gene:SK14 / 814846 AraportID:AT2G03170 Length:149 Species:Arabidopsis thaliana


Alignment Length:157 Identity:53/157 - (33%)
Similarity:81/157 - (51%) Gaps:17/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANH 65
            |.:..|.|.||:|..|..|..||...:.::.|::...|..:    |||.:|:...|..::.:...
plant     1 MSSNKIVLSSSDGESFEVEEAVARKLKIVEHMIEDDCVVTE----VPLQNVTGKILSIVVEYCKK 61

  Fly    66 HKDDDDQSTEGEELKPRRPYAISPWDAIFL-MVNSTTLLEIILAAKQLQIKGLLELTYNVVANMI 129
            |..|:    |.:|.|        .||..|: ..:..|:.:::|||..|.|||||:|:...||:.|
plant    62 HVVDE----ESDEFK--------TWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRI 114

  Fly   130 RGKTPEEIRFIFNIPEDVSPSVDGELR 156
            :.|||||||.||||..|.:|..:..:|
plant   115 KDKTPEEIREIFNIENDFTPEEEAAVR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 51/153 (33%)
BTB 6..114 CDD:295341 29/108 (27%)
Skp1 88..156 CDD:279768 30/68 (44%)
SK14NP_565296.1 SKP1 3..147 CDD:227528 52/155 (34%)
Skp1 3..99 CDD:214704 29/111 (26%)
Skp1 72..147 CDD:279768 32/78 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.