DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SKP1

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_733779.1 Gene:SKP1 / 6500 HGNCID:10899 Length:163 Species:Homo sapiens


Alignment Length:154 Identity:72/154 - (46%)
Similarity:98/154 - (63%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQND-ENAIVPLHSVSTFTLGKILAWANHHK 67
            |:|||:||:|.||..:|.:|..|.||||||:...:.:: ::..|||.:|:...|.|::.|..|||
Human     2 PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHK 66

  Fly    68 DDDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIRGK 132
             ||....|.:|.|.:|...|..||..||.|:..||.|:||||..|.|||||::|...|||||:||
Human    67 -DDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   133 TPEEIRFIFNIPEDVSPSVDGELR 156
            ||||||..|||..|.:...:.::|
Human   131 TPEEIRKTFNIKNDFTEEEEAQVR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 71/152 (47%)
BTB 6..114 CDD:295341 47/108 (44%)
Skp1 88..156 CDD:279768 36/67 (54%)
SKP1NP_733779.1 BTB_POZ_SKP1 4..127 CDD:349631 56/123 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..83 9/20 (45%)
Interaction with the F-box domain of F-box proteins. /evidence=ECO:0000250 104..163 29/51 (57%)
Skp1 113..160 CDD:396171 23/42 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149262
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.