DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and skp1

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001016519.1 Gene:skp1 / 549273 XenbaseID:XB-GENE-919631 Length:163 Species:Xenopus tropicalis


Alignment Length:154 Identity:72/154 - (46%)
Similarity:98/154 - (63%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQND-ENAIVPLHSVSTFTLGKILAWANHHK 67
            |:|||:||:|.||..:|.:|..|.||||||:...:.:: ::..|||.:|:...|.|::.|..|||
 Frog     2 PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHK 66

  Fly    68 DDDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIRGK 132
             ||....|.:|.|.:|...|..||..||.|:..||.|:||||..|.|||||::|...|||||:||
 Frog    67 -DDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   133 TPEEIRFIFNIPEDVSPSVDGELR 156
            ||||||..|||..|.:...:.::|
 Frog   131 TPEEIRKTFNIKNDFTEEEEAQVR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 71/152 (47%)
BTB 6..114 CDD:295341 47/108 (44%)
Skp1 88..156 CDD:279768 36/67 (54%)
skp1NP_001016519.1 BTB_POZ_SKP1 4..127 CDD:349631 56/123 (46%)
Skp1 113..160 CDD:396171 23/42 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.