DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and skp1

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_957037.1 Gene:skp1 / 393716 ZFINID:ZDB-GENE-040426-1707 Length:163 Species:Danio rerio


Alignment Length:154 Identity:72/154 - (46%)
Similarity:98/154 - (63%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQND-ENAIVPLHSVSTFTLGKILAWANHHK 67
            |||||:||:|.:|..:|.:|..|.||||||:...:.:: ::..|||.:|:...|.|::.|..|||
Zfish     2 PTIKLQSSDGEMFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHK 66

  Fly    68 DDDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIRGK 132
             ||....|.:|.|.:|...|..||..||.|:..||.|:||||..|.|||||::|...|||||:||
Zfish    67 -DDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   133 TPEEIRFIFNIPEDVSPSVDGELR 156
            ||||||..|||..|.:...:.::|
Zfish   131 TPEEIRKTFNIKNDFTEEEEAQVR 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 71/152 (47%)
BTB 6..114 CDD:295341 46/108 (43%)
Skp1 88..156 CDD:279768 36/67 (54%)
skp1NP_957037.1 BTB_POZ_SKP1 3..127 CDD:349631 56/124 (45%)
Skp1 113..160 CDD:396171 23/42 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583347
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.