DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SkpF

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_611796.1 Gene:SkpF / 37713 FlyBaseID:FBgn0034863 Length:171 Species:Drosophila melanogaster


Alignment Length:147 Identity:67/147 - (45%)
Similarity:92/147 - (62%) Gaps:1/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANHHKD 68
            |.|||:||:|.||.|::..|..|.||||:|:...|:.:.:.::||.:|::..|.|:|.||.||::
  Fly     2 PVIKLQSSDGEIFETDIETAKCSSTIKTLLEDCPVEAENDTLIPLPNVNSTILKKVLIWAKHHRE 66

  Fly    69 DDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIRGKT 133
            |..:..| ||........|:||||.||.::..||.|:||||..|.|..||......|||||:|:|
  Fly    67 DIAEENE-EEAAKSVAVQITPWDAEFLSMDQGTLFELILAANYLDIPNLLNAACMTVANMIKGRT 130

  Fly   134 PEEIRFIFNIPEDVSPS 150
            .||||..|:|..|.|||
  Fly   131 TEEIRQTFHITNDFSPS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 67/147 (46%)
BTB 6..114 CDD:295341 46/107 (43%)
Skp1 88..156 CDD:279768 34/63 (54%)
SkpFNP_611796.1 SKP1 1..157 CDD:227528 67/147 (46%)
Skp1 1..111 CDD:214704 47/109 (43%)
Skp1 87..157 CDD:279768 33/61 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452333
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.