DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and SkpB

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_610729.1 Gene:SkpB / 36298 FlyBaseID:FBgn0026176 Length:161 Species:Drosophila melanogaster


Alignment Length:153 Identity:68/153 - (44%)
Similarity:98/153 - (64%) Gaps:2/153 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANHHKD 68
            |.|:|||::..||.|:..:|..||||:..::....::| |:::||.:|::..|.|:|.||.:|| 
  Fly     2 PIIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESD-NSVLPLPNVNSLILKKVLHWATYHK- 64

  Fly    69 DDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIRGKT 133
            ||...||..|.|.:|...||.|||.||.|:..||.|:||||..|.|:|||::|...|||||:||:
  Fly    65 DDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFELILAANYLNIQGLLDVTCKTVANMIKGKS 129

  Fly   134 PEEIRFIFNIPEDVSPSVDGELR 156
            |:.||..|.|..|..|..:.::|
  Fly   130 PQAIRDTFAIQNDFLPQEEEQVR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 67/151 (44%)
BTB 6..114 CDD:295341 47/107 (44%)
Skp1 88..156 CDD:279768 34/67 (51%)
SkpBNP_610729.1 SKP1 1..161 CDD:227528 68/153 (44%)
Skp1 1..110 CDD:214704 48/109 (44%)
Skp1 84..158 CDD:279768 35/69 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452340
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.