DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and Skp1

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_038941314.1 Gene:Skp1 / 287280 RGDID:1359648 Length:165 Species:Rattus norvegicus


Alignment Length:157 Identity:74/157 - (47%)
Similarity:99/157 - (63%) Gaps:2/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTIKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQND-ENAIVPLHSVSTFTLGKILAWAN 64
            |..|||||:||:|.||..:|.:|..|.||||||:...:.:: ::..|||.:|:...|.|::.|..
  Rat     1 MQMPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCT 65

  Fly    65 HHKDDDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMI 129
            ||| ||....|.:|.|.:|...|..||..||.|:..||.|:||||..|.|||||::|...|||||
  Rat    66 HHK-DDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMI 129

  Fly   130 RGKTPEEIRFIFNIPEDVSPSVDGELR 156
            :||||||||..|||..|.:...:.::|
  Rat   130 KGKTPEEIRKTFNIKNDFTEEEEAQVR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 72/153 (47%)
BTB 6..114 CDD:295341 47/108 (44%)
Skp1 88..156 CDD:279768 36/67 (54%)
Skp1XP_038941314.1 BTB_POZ_SKP1 5..129 CDD:349631 57/124 (46%)
Skp1 115..162 CDD:396171 23/42 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343135
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.