DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and skp1

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_595455.1 Gene:skp1 / 2540917 PomBaseID:SPBC409.05 Length:161 Species:Schizosaccharomyces pombe


Alignment Length:159 Identity:63/159 - (39%)
Similarity:90/159 - (56%) Gaps:8/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANHHKDDD 70
            |||.||:...|..:..:|..|..||.||:..   .:.|..:||.:||:..|.|:|.|..|||:|.
pombe     4 IKLISSDNEEFVVDQLIAERSMLIKNMLEDV---GEINVPIPLPNVSSNVLRKVLEWCEHHKNDL 65

  Fly    71 DQSTEGE-ELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIRGKTP 134
            ...||.| :::.::...|..||..|:.|:...|.||:||:..|.||.||:.....||||||||:|
pombe    66 YSGTEEESDIRLKKSTDIDEWDRKFMAVDQEMLFEIVLASNYLDIKPLLDTGCKTVANMIRGKSP 130

  Fly   135 EEIRFIFNIPEDVSPSVDGELR----WKD 159
            |:||..||||.|.:|..:.::|    |.:
pombe   131 EDIRKTFNIPNDFTPEEEEQIRKENEWAE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 61/150 (41%)
BTB 6..114 CDD:295341 39/108 (36%)
Skp1 88..156 CDD:279768 32/67 (48%)
skp1NP_595455.1 SKP1 1..161 CDD:227528 63/159 (40%)
Skp1 1..110 CDD:214704 39/108 (36%)
Skp1 84..158 CDD:279768 33/73 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I2981
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.