DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and skr-19

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_510193.4 Gene:skr-19 / 181446 WormBaseID:WBGene00004825 Length:155 Species:Caenorhabditis elegans


Alignment Length:144 Identity:43/144 - (29%)
Similarity:64/144 - (44%) Gaps:26/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTI--KLESSEGVIFPTEVRVAMVSETIKTM-----LDHFAVQNDENAIVPLHSVSTFTLGKILA 61
            |.|  ||.|::|..|..:.|...:...|:.:     ||  .:..|:...:.|...:| .:.|::.
 Worm     6 PVILYKLRSTDGQRFLADRRTIGMIGRIEDLFRNAGLD--LIPADQLQPIQLEIPAT-VMRKVIE 67

  Fly    62 WANHHKDD---DDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYN 123
            |.:|||.|   |:...|..:        |..|||.||||....|.:||.||:...:.||..:...
 Worm    68 WCDHHKHDPPYDESEPETND--------IPDWDASFLMVRHNMLFDIIRAARDFTVPGLFAMCCR 124

  Fly   124 VVANMIRGKTPEEI 137
            ||     |:.|.||
 Worm   125 VV-----GQNPREI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 43/144 (30%)
BTB 6..114 CDD:295341 34/117 (29%)
Skp1 88..156 CDD:279768 20/50 (40%)
skr-19NP_510193.4 BTB_POZ_SKP1 9..129 CDD:349631 38/135 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.