DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and skr-7

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_504221.1 Gene:skr-7 / 178840 WormBaseID:WBGene00004813 Length:194 Species:Caenorhabditis elegans


Alignment Length:153 Identity:43/153 - (28%)
Similarity:79/153 - (51%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTI-KLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAI--VPLHSVSTFTLGKILAW 62
            :|.|.: |:|||:|.::.........|.|:..::. ..|.||..::  :|:.:|:...:..::.|
 Worm    17 IVAPIMYKVESSDGQVYEISDEAVKQSNTLSNLIS-TCVANDVASMDPIPITNVTGNIMKMVIEW 80

  Fly    63 ANHHKDD----DDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYN 123
            ...||.:    :|.|.      |:. ..:..||..||.:::..|.::|:|:..|.:.||:.....
 Worm    81 CEKHKGETLPVEDDSV------PKN-ITVPEWDTNFLKIDNDVLFDLIVASNFLDVPGLMSYACK 138

  Fly   124 VVANMIRGKTPEEIRFIFNIPED 146
            :||||..||:|:|:|.:|.||.|
 Worm   139 MVANMAIGKSPDEMRVLFAIPTD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 42/151 (28%)
BTB 6..114 CDD:295341 26/114 (23%)
Skp1 88..156 CDD:279768 23/59 (39%)
skr-7NP_504221.1 Skp1 20..129 CDD:214704 27/116 (23%)
Skp1 103..>160 CDD:279768 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160620
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.